Weekly Remedy Schedule: Fasting & Charity Guide

Weekly Remedy Schedule: Fasting & Charity Guide

by VedicGod Editorial Team 4 min read
remediescalendarfastingcharityweekday

This weekly remedy schedule gives you one clear focus per day so your fasting, mantras, and charity stay consistent. Pair it with the Planetary Charity Calendar 2027 for annual highlights and the Planetary Charity Calendar 2026 hub for deeper festival windows. Use the Mantra Practice Counter when you want to keep 27 or 108 weekday chants on track without losing count, and the astrology and yoga guide when you want a matching movement or breath routine.

One-Glance Weekly Plan (IST)

DayPlanetFasting FocusCharity IdeaMantra (simple meaning)Add-On
MondayMoonLight or milk fastMilk, rice, women’s health“Om Somaya Namah” (I calm my mind)Night gratitude journal
TuesdayMarsProtein-light fastRed lentils, sports gear“Om Mangalaya Namah” (I act with courage)20 push-ups or brisk walk
WednesdayMercuryFresh fruits fastBooks, stationery“Om Budhaya Namah” (I speak clearly)Declutter your desk
ThursdayJupiterSattvic (clean) mealsYellow pulses, education aid“Om Brihaspataye Namah” (I grow wisdom)Teach or mentor for 20 minutes
FridayVenusSimple sweets onlyArt supplies, white flowers“Om Shukraya Namah” (I invite harmony)10-minute music or dance
SaturdaySaturnOne-meal fastBlack sesame, oil, worker welfare“Om Shanaye Namah” (I respect discipline)Pay dues/bills on time
SundaySunSunrise water offeringSolar lamps, warm clothes“Om Surya Namah” (I welcome light)10-minute sun salutations

Quick Rules

  • Keep water and electrolytes handy; remedies should support you, not exhaust you.
  • Skip or soften fasts if you are unwell—offer charity and chant instead.
  • First mention Vedic terms in plain English: Rahu Kalam (shadow period) is the midday hour to avoid new starts; use it for reflection, not launches.

30-Minute Sunday Setup

  1. Lock your anchor days: Moon on Monday, Saturn on Saturday, Sun on Sunday.
  2. Pre-pack micro-kits: Small packets of rice, sesame, flowers, art supplies, and yellow pulses; store them by weekday.
  3. Schedule reminders: Add 15-minute blocks for fasting check-ins and charity send-outs; stagger for IST, PST, and GMT if family is global.
  4. Add 3 internal links: Bookmark Weekly Moon Sign Predictions Guide, Quarterly Remedy Calendar Q1 2026, and Vedic Remedies for Career Success for inspiration.

Fasting & Charity Playbook by Planet

Moon (Mind Steadiness) — Monday

  • Light fast with milk, rice, or fruit.
  • Donate milk, white clothes, or menstrual health kits.
  • Evening check-in: one page of feelings + three wins.

Mars (Action) — Tuesday

  • Protein-light meals; avoid excess caffeine.
  • Donate red lentils, sports shoes, or first-aid kits.
  • Short workout to channel energy; end with 5 slow breaths.

Mercury (Clarity) — Wednesday

  • Fresh fruits and simple grains; reduce screen time in the evening.
  • Donate books, stationery, or pay for a student’s data pack.
  • Do a clutter clear in one drawer to reset your mind.

Jupiter (Wisdom) — Thursday

  • Sattvic meals (no heavy fried food).
  • Donate yellow pulses, turmeric, or tuition support.
  • Share one learning with a friend; teaching anchors the remedy. For career-specific use, follow the Thursday remedies for job success checklist.

Venus (Harmony) — Friday

  • Simple sweets + plenty of water.
  • Donate art supplies, white flowers, music therapy support.
  • Do a 10-minute creative session to soothe the heart.

Saturn (Discipline) — Saturday

  • One-meal fast or skip one course; keep digestion light.
  • Donate black sesame, oil, umbrellas, or worker safety gear.
  • Pay pending bills; call elders or mentors to express respect.

Sun (Vitality) — Sunday

  • Sunrise arghya (water offering) with intention.
  • Donate solar lamps, warm clothes, leadership books.
  • Do Surya Namaskar (sun salutations) at your pace.

Time-Zone Adjustments

  • US West (PST): Do the fast/charity the previous evening; Tuesday Mars = Monday 6 PM PST.
  • US East (EST): Early morning works; Thursday Jupiter = 7-8 AM EST.
  • UK/EU: Same calendar day; subtract hours from IST reminders.
  • APAC: You are ahead—perform remedies first and share photos for others to mirror.

Mini Checklists You Can Reuse

  • Add weekly reminder titles: “Monday Moon calm”, “Saturday Saturn steady”.
  • Keep ₹111 / $3 envelopes per planet; refill on Thursdays (Jupiter day).
  • Save donation receipts in a single album; note mood changes after each fast.
  • Rotate one Rahu Kalam (shadow period) reflection each week—journal instead of starting new tasks.
  • Link back to the hub Planetary Charity Calendar 2026 so family can see the bigger plan.

Consistency beats intensity. If you miss a fast, keep the charity and mantra; the streak lives as long as your intention stays gentle and regular.

VedicGod Editorial Team

VedicGod Editorial Team

The VedicGod Editorial Team combines expertise in classical Vedic Astrology (Jyotish) with modern data-driven analysis. Our content is reviewed by certified Jyotish practitioners and grounded in authoritative texts like Brihat Parashara Hora Shastra. We're committed to making ancient wisdom accessible while maintaining accuracy and cultural authenticity.